Lineage for d4q1ra_ (4q1r A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779208Protein Galectin-1 [100925] (5 species)
  7. 2779225Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
    Uniprot P09382
  8. 2779240Domain d4q1ra_: 4q1r A: [277874]
    automated match to d1gzwa_
    complexed with 2xu, so4

Details for d4q1ra_

PDB Entry: 4q1r (more details), 1.47 Å

PDB Description: galectin-1 in complex with ligand an027
PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d4q1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1ra_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

SCOPe Domain Coordinates for d4q1ra_:

Click to download the PDB-style file with coordinates for d4q1ra_.
(The format of our PDB-style files is described here.)

Timeline for d4q1ra_: