Lineage for d5dxwa_ (5dxw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744221Domain d5dxwa_: 5dxw A: [277871]
    automated match to d4jvpa_
    complexed with so4

Details for d5dxwa_

PDB Entry: 5dxw (more details), 1.44 Å

PDB Description: crystal structure of mouse pd-l1 nanobody
PDB Compounds: (A:) PD-L1 nanobody

SCOPe Domain Sequences for d5dxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dxwa_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvetggglvqpggslrlsctasgftfsmhamtwyrqapgkqrelvavitshgdrany
tdsvrgrftisrdntknmvylqmnslkpedtavyycnvprydswgqgtqvtvss

SCOPe Domain Coordinates for d5dxwa_:

Click to download the PDB-style file with coordinates for d5dxwa_.
(The format of our PDB-style files is described here.)

Timeline for d5dxwa_: