SCOP 1.65: Domain d1bf2_2: 1bf2 638-750

Lineage for d1bf2_2 (1bf2 638-750)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Isoamylase [51036] (1 species)

7. Species Pseudomonas amyloderamosa [TaxId:32043] [51037] (1 PDB entry)

8. Domain d1bf2_2: 1bf2 638-750 [27787]
   Other proteins in same PDB: d1bf2_1, d1bf2_3
   complexed with ca

Details for d1bf2_2

PDB Entry: 1bf2, 2 Å

PDB Description: structure of pseudomonas isoamylase

SCOP Domain Sequences for d1bf2_2:

Sequence; same for both SEQRES and ATOM records:

>d1bf2_2 b.71.1.1 (638-750) Isoamylase {Pseudomonas amyloderamosa}
ysgsqltwyqpsgavadsnywnntsnyaiayaingpslgdsnsiyvayngwsssvtftlp
appsgtqwyrvtdtcdwndgastfvapgsetliggagttygqcgqsllllisk

Timeline for d1bf2_2:

• d1bf2_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bf2_2 appears in SCOP 1.63
  
• d1bf2_2 appears in SCOP 1.67
  
• d1bf2_2 appears in the current release, SCOPe 2.08, called d1bf2a2