Lineage for d1bf2a2 (1bf2 A:638-750)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400614Protein Isoamylase [51036] (1 species)
  7. 2400615Species Pseudomonas amyloderamosa [TaxId:32043] [51037] (1 PDB entry)
  8. 2400616Domain d1bf2a2: 1bf2 A:638-750 [27787]
    Other proteins in same PDB: d1bf2a1, d1bf2a3
    complexed with ca

Details for d1bf2a2

PDB Entry: 1bf2 (more details), 2 Å

PDB Description: structure of pseudomonas isoamylase
PDB Compounds: (A:) isoamylase

SCOPe Domain Sequences for d1bf2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf2a2 b.71.1.1 (A:638-750) Isoamylase {Pseudomonas amyloderamosa [TaxId: 32043]}
ysgsqltwyqpsgavadsnywnntsnyaiayaingpslgdsnsiyvayngwsssvtftlp
appsgtqwyrvtdtcdwndgastfvapgsetliggagttygqcgqsllllisk

SCOPe Domain Coordinates for d1bf2a2:

Click to download the PDB-style file with coordinates for d1bf2a2.
(The format of our PDB-style files is described here.)

Timeline for d1bf2a2: