SCOPe 2.08: Domain d5dzsb2: 5dzs B:101-269

Lineage for d5dzsb2 (5dzs B:101-269)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Peptoclostridium difficile [TaxId:272563] [277867] (1 PDB entry)

8. Domain d5dzsb2: 5dzs B:101-269 [277869]
   Other proteins in same PDB: d5dzsa1, d5dzsa3, d5dzsb1, d5dzsb3
   automated match to d2hk9a2
   complexed with so4

Details for d5dzsb2

PDB Entry: 5dzs, 1.5 Å

PDB Description: 1.5 angstrom crystal structure of shikimate dehydrogenase 1 from peptoclostridium difficile.

PDB Compounds: (B:) Shikimate dehydrogenase (NADP(+))

SCOPe Domain Sequences for d5dzsb2:

Sequence; same for both SEQRES and ATOM records:

>d5dzsb2 c.2.1.0 (B:101-269) automated matches {Peptoclostridium difficile [TaxId: 272563]}
dyfgldsmfkmanidvqgkvavilgtggaskaaltyfidsgieklyvstrkkddkkllns
kailidyeelkhikgdiilnatpvgmypnvgispvsksiiqnfdilidliynpgeteflr
ignsmgkktcdglymlvgqaiksqeiwqdtkidnsildviynelklefl

Timeline for d5dzsb2:

• d5dzsb2 first appeared in SCOPe 2.05
  
• d5dzsb2 appears in SCOPe 2.07