SCOPe 2.07: Domain d5djvf_: 5djv F:

Lineage for d5djvf_ (5djv F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)

8. Domain d5djvf_: 5djv F: [277862]
   automated match to d4demf_
   complexed with 5bl

Details for d5djvf_

PDB Entry: 5djv, 2.3 Å

PDB Description: crystal structure of human fpps in complex with biaryl compound 8e

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d5djvf_:

Sequence; same for both SEQRES and ATOM records:

>d5djvf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

Timeline for d5djvf_:

• d5djvf_ first appeared in SCOPe 2.05
  
• d5djvf_ appears in SCOPe 2.06
  
• d5djvf_ appears in the current release, SCOPe 2.08