SCOPe 2.08: Domain d5cckl1: 5cck L:3-107

Lineage for d5cckl1 (5cck L:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5cckl1: 5cck L:3-107 [277856]
   Other proteins in same PDB: d5cckl2
   automated match to d2mcg11
   complexed with cxs

Details for d5cckl1

PDB Entry: 5cck, 1.95 Å

PDB Description: crystal structure of human anti-hiv-1 broadly neutralizing antibody 3bc315 fab

PDB Compounds: (L:) Antibody 3BC315 Fab light chain

SCOPe Domain Sequences for d5cckl1:

Sequence; same for both SEQRES and ATOM records:

>d5cckl1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsaspgqsitiscsgtrsdvggydfvswyqqhpgkvpkliiyevtkrpsgipq
rfsgsksgntasltisglqaddeadyyccsyanydklilgggtkltvlg

Timeline for d5cckl1:

• d5cckl1 first appeared in SCOPe 2.05
  
• d5cckl1 appears in SCOPe 2.07