Lineage for d1eh9a2 (1eh9 A:491-557)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420061Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)
  7. 2420072Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries)
  8. 2420079Domain d1eh9a2: 1eh9 A:491-557 [27785]
    Other proteins in same PDB: d1eh9a1, d1eh9a3

Details for d1eh9a2

PDB Entry: 1eh9 (more details), 3 Å

PDB Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
PDB Compounds: (A:) glycosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d1eh9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh9a2 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk

SCOPe Domain Coordinates for d1eh9a2:

Click to download the PDB-style file with coordinates for d1eh9a2.
(The format of our PDB-style files is described here.)

Timeline for d1eh9a2: