Lineage for d1eh9a2 (1eh9 A:491-557)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 171074Protein Glycosyltrehalose trehalohydrolase [51034] (1 species)
  7. 171075Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (2 PDB entries)
  8. 171076Domain d1eh9a2: 1eh9 A:491-557 [27785]
    Other proteins in same PDB: d1eh9a1, d1eh9a3

Details for d1eh9a2

PDB Entry: 1eh9 (more details), 3 Å

PDB Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase

SCOP Domain Sequences for d1eh9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh9a2 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Archaeon Sulfolobus solfataricus, km1}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk

SCOP Domain Coordinates for d1eh9a2:

Click to download the PDB-style file with coordinates for d1eh9a2.
(The format of our PDB-style files is described here.)

Timeline for d1eh9a2: