Lineage for d5cdfa3 (5cdf A:381-511)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717661Species Paracoccus denitrificans [TaxId:266] [277845] (1 PDB entry)
  8. 2717662Domain d5cdfa3: 5cdf A:381-511 [277849]
    Other proteins in same PDB: d5cdfa1, d5cdfa2, d5cdfe1, d5cdfe2
    automated match to d1maba1
    complexed with gol, po4

Details for d5cdfa3

PDB Entry: 5cdf (more details), 2.3 Å

PDB Description: structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans
PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5cdfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cdfa3 a.69.1.0 (A:381-511) automated matches {Paracoccus denitrificans [TaxId: 266]}
tkamksvagpvklelaqyremaafaqfgsdldaatqkllnrgarltelmkqpqyspltna
eiviviyagtkgyldgipvrdvtkwehgllqylrnqkadlledmtkndrkvageledaik
aaldgyaktya

SCOPe Domain Coordinates for d5cdfa3:

Click to download the PDB-style file with coordinates for d5cdfa3.
(The format of our PDB-style files is described here.)

Timeline for d5cdfa3: