![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:266] [277845] (1 PDB entry) |
![]() | Domain d5cdfa3: 5cdf A:381-511 [277849] Other proteins in same PDB: d5cdfa1, d5cdfa2, d5cdfe1, d5cdfe2 automated match to d1maba1 complexed with gol, po4 |
PDB Entry: 5cdf (more details), 2.3 Å
SCOPe Domain Sequences for d5cdfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cdfa3 a.69.1.0 (A:381-511) automated matches {Paracoccus denitrificans [TaxId: 266]} tkamksvagpvklelaqyremaafaqfgsdldaatqkllnrgarltelmkqpqyspltna eiviviyagtkgyldgipvrdvtkwehgllqylrnqkadlledmtkndrkvageledaik aaldgyaktya
Timeline for d5cdfa3: