SCOPe 2.06: Domain d5cdfa2: 5cdf A:95-380

Lineage for d5cdfa2 (5cdf A:95-380)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [277843] (1 PDB entry)

8. Domain d5cdfa2: 5cdf A:95-380 [277848]
   Other proteins in same PDB: d5cdfa1, d5cdfa3, d5cdfe1, d5cdfe3
   automated match to d1maba3
   complexed with gol, po4

Details for d5cdfa2

PDB Entry: 5cdf, 2.3 Å

PDB Description: structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans

PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5cdfa2:

Sequence; same for both SEQRES and ATOM records:

>d5cdfa2 c.37.1.0 (A:95-380) automated matches {Paracoccus denitrificans [TaxId: 266]}
vevpagkellgrvvdalgnpidgkgplnaserriadvkapgimprksvhepmatglksvd
amipvgrgqreliigdrqtgktaialdtilnqanyngreadgmktlhciyvavgqkrstv
aqlvkkleetgamayttvvaatasdpapmqylapysatamgeyfrdngmdaliiyddlsk
qavayrqmslllrrppgreaypgdvfylhsrllersaklneangagsltalpiietqagd
vsayiptnvisitdgqifletelffqgirpavntglsvsrvgsaaq

Timeline for d5cdfa2:

• d5cdfa2 first appeared in SCOPe 2.05
  
• d5cdfa2 appears in SCOPe 2.07
  
• d5cdfa2 appears in the current release, SCOPe 2.08