SCOPe 2.08: Domain d5cdfe3: 5cdf E:354-469

Lineage for d5cdfe3 (5cdf E:354-469)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [277845] (1 PDB entry)

8. Domain d5cdfe3: 5cdf E:354-469 [277846]
   Other proteins in same PDB: d5cdfa1, d5cdfa2, d5cdfe1, d5cdfe2
   automated match to d4q4la3
   complexed with gol, po4

Details for d5cdfe3

PDB Entry: 5cdf, 2.3 Å

PDB Description: structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d5cdfe3:

Sequence; same for both SEQRES and ATOM records:

>d5cdfe3 a.69.1.0 (E:354-469) automated matches {Paracoccus denitrificans [TaxId: 266]}
ldpavvgeehyqvardvqgilqkykslqdiiailgmdelseedkltvararkiqrflsqp
fdvakvftgsdgvqvpledtiksfkavvageydhlpeaafymvggiedvkakaqrl

Timeline for d5cdfe3:

• d5cdfe3 first appeared in SCOPe 2.05
  
• d5cdfe3 appears in SCOPe 2.07