Lineage for d5cdfe2 (5cdf E:77-353)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114571Species Paracoccus denitrificans [TaxId:266] [277843] (1 PDB entry)
  8. 2114573Domain d5cdfe2: 5cdf E:77-353 [277844]
    Other proteins in same PDB: d5cdfa1, d5cdfa3, d5cdfe1, d5cdfe3
    automated match to d4q4la2
    complexed with gol, po4

Details for d5cdfe2

PDB Entry: 5cdf (more details), 2.3 Å

PDB Description: structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans
PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d5cdfe2:

Sequence, based on SEQRES records: (download)

>d5cdfe2 c.37.1.0 (E:77-353) automated matches {Paracoccus denitrificans [TaxId: 266]}
imvpvgdatlgrilnvvgepvdeggpveatqtraihqqapdfaaqataseilvtgikvid
llapyskggkiglfggagvgktvlimelinniakvhsgysvfagvgertregndlyhemv
esgvikpddlsksqvalvygqmneppgarmrvaltgltvaeqfrdatgtdvlffvdnifr
ftqagsevsallgripsavgyqptlatdmgamqeritstkngsitsiqavyvpaddltdp
apattfahldattvlsraiselgiypavdpldsnsri

Sequence, based on observed residues (ATOM records): (download)

>d5cdfe2 c.37.1.0 (E:77-353) automated matches {Paracoccus denitrificans [TaxId: 266]}
imvpvgdatlgrilnvvgepvdeggpveatqtraihqqapdfaaqataseilvtgikvid
llapyskggkiglfggagvgktvlimelinniakvhsgysvfagvgertregndlyhemv
esgvikpddlsksqvalvygqmneppgarmrvaltgltvaeqfrdatgtdvlffvdnifr
ftqagsevsallgripsptlatdmgamqeritstkngsitsiqavyvpaddltttfahld
attvlsraiselgiypavdpldsnsri

SCOPe Domain Coordinates for d5cdfe2:

Click to download the PDB-style file with coordinates for d5cdfe2.
(The format of our PDB-style files is described here.)

Timeline for d5cdfe2: