Lineage for d1bvzb2 (1bvz B:503-585)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302223Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 302224Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) (S)
  5. 302225Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 302409Protein Maltogenic amylase [51031] (4 species)
  7. 302418Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries)
  8. 302422Domain d1bvzb2: 1bvz B:503-585 [27784]
    Other proteins in same PDB: d1bvza1, d1bvza3, d1bvzb1, d1bvzb3

Details for d1bvzb2

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvzb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1bvzb2:

Click to download the PDB-style file with coordinates for d1bvzb2.
(The format of our PDB-style files is described here.)

Timeline for d1bvzb2: