SCOPe 2.05: Domain d5c2ha_: 5c2h A:

Lineage for d5c2ha_ (5c2h A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d5c2ha_: 5c2h A: [277838]
   automated match to d2ourb_
   complexed with 4px, 4xu, mg, zn

Details for d5c2ha_

PDB Entry: 5c2h, 2.09 Å

PDB Description: pde10 complexed with 6-chloro-n-[(2,4-dimethylthiazol-5-yl)methyl]-5- methyl-2-[3-(2-quinolyl)propoxy]pyrimidin-4-amine

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c2ha_:

Sequence; same for both SEQRES and ATOM records:

>d5c2ha_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyr
rvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdh
plaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfg
nrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaeg
demkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnls
qwekvirg

Timeline for d5c2ha_:

• d5c2ha_ is new in SCOPe 2.05-stable
  
• d5c2ha_ appears in SCOPe 2.06
  
• d5c2ha_ appears in the current release, SCOPe 2.08