Lineage for d5c2ha_ (5c2h A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (7 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (95 PDB entries)
  8. 2015386Domain d5c2ha_: 5c2h A: [277838]
    Other proteins in same PDB: d5c2hb2
    automated match to d2ourb_
    complexed with 4px, 4xu, mg, zn

Details for d5c2ha_

PDB Entry: 5c2h (more details), 2.09 Å

PDB Description: pde10 complexed with 6-chloro-n-[(2,4-dimethylthiazol-5-yl)methyl]-5- methyl-2-[3-(2-quinolyl)propoxy]pyrimidin-4-amine
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2ha_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyr
rvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdh
plaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfg
nrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaeg
demkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnls
qwekvirg

SCOPe Domain Coordinates for d5c2ha_:

Click to download the PDB-style file with coordinates for d5c2ha_.
(The format of our PDB-style files is described here.)

Timeline for d5c2ha_: