SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5c2ha_ (5c2h A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (8 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (103 PDB entries)
  8. 2015386Domain d5c2ha_: 5c2h A: [277838]
    Other proteins in same PDB: d5c2hb2
    automated match to d2ourb_
    complexed with 4px, 4xu, mg, zn

Details for d5c2ha_

PDB Entry: 5c2h (more details), 2.09 Å

PDB Description: pde10 complexed with 6-chloro-n-[(2,4-dimethylthiazol-5-yl)methyl]-5- methyl-2-[3-(2-quinolyl)propoxy]pyrimidin-4-amine
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2ha_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyr
rvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdh
plaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfg
nrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaeg
demkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnls
qwekvirg

SCOPe Domain Coordinates for d5c2ha_:

Click to download the PDB-style file with coordinates for d5c2ha_.
(The format of our PDB-style files is described here.)

Timeline for d5c2ha_: