![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein automated matches [190564] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries) |
![]() | Domain d5bzzc2: 5bzz C:188-351 [277836] Other proteins in same PDB: d5bzza1, d5bzzb1, d5bzzc1, d5bzzd1 automated match to d1d5ra1 complexed with tla |
PDB Entry: 5bzz (more details), 2.2 Å
SCOPe Domain Sequences for d5bzzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bzzc2 b.7.1.1 (C:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]} yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd kanryfspnfkvklyftktv
Timeline for d5bzzc2: