Lineage for d5bzzd1 (5bzz D:14-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875165Protein automated matches [190696] (6 species)
    not a true protein
  7. 2875201Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries)
  8. 2875217Domain d5bzzd1: 5bzz D:14-187 [277834]
    Other proteins in same PDB: d5bzza2, d5bzzb2, d5bzzc2, d5bzzd2
    automated match to d1d5ra2
    complexed with tla

Details for d5bzzd1

PDB Entry: 5bzz (more details), 2.2 Å

PDB Description: crystal structure of human phosphatase pten in its reduced state
PDB Compounds: (D:) Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

SCOPe Domain Sequences for d5bzzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bzzd1 c.45.1.1 (D:14-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae
rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv
micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhld

SCOPe Domain Coordinates for d5bzzd1:

Click to download the PDB-style file with coordinates for d5bzzd1.
(The format of our PDB-style files is described here.)

Timeline for d5bzzd1: