![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
![]() | Protein automated matches [190696] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries) |
![]() | Domain d5bzzb1: 5bzz B:14-187 [277831] Other proteins in same PDB: d5bzza2, d5bzzb2, d5bzzc2, d5bzzd2 automated match to d1d5ra2 complexed with tla |
PDB Entry: 5bzz (more details), 2.2 Å
SCOPe Domain Sequences for d5bzzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bzzb1 c.45.1.1 (B:14-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhld
Timeline for d5bzzb1: