Lineage for d1bvza2 (1bvz A:503-585)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17394Protein Maltogenic amylase [51031] (2 species)
  7. 17395Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (1 PDB entry)
  8. 17396Domain d1bvza2: 1bvz A:503-585 [27783]
    Other proteins in same PDB: d1bvza1, d1bvza3, d1bvzb1, d1bvzb3

Details for d1bvza2

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvza2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1bvza2:

Click to download the PDB-style file with coordinates for d1bvza2.
(The format of our PDB-style files is described here.)

Timeline for d1bvza2: