SCOP 1.55: Domain d1bvza2: 1bvz A:503-585

Lineage for d1bvza2 (1bvz A:503-585)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)

6. Protein Maltogenic amylase [51031] (2 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (1 PDB entry)

8. Domain d1bvza2: 1bvz A:503-585 [27783]
   Other proteins in same PDB: d1bvza1, d1bvza3, d1bvzb1, d1bvzb3

Details for d1bvza2

PDB Entry: 1bvz, 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvza2:

Sequence; same for both SEQRES and ATOM records:

>d1bvza2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1bvza2:

• d1bvza2 appears in SCOP 1.57
  
• d1bvza2 appears in the current release, SCOPe 2.08