Lineage for d5bzxd2 (5bzx D:188-351)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772932Protein automated matches [190564] (3 species)
    not a true protein
  7. 2772937Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries)
  8. 2772950Domain d5bzxd2: 5bzx D:188-351 [277825]
    Other proteins in same PDB: d5bzxa1, d5bzxb1, d5bzxc1, d5bzxd1
    automated match to d1d5ra1
    complexed with tla, vo4

Details for d5bzxd2

PDB Entry: 5bzx (more details), 2.5 Å

PDB Description: crystal structure of human phosphatase pten treated with a bisperoxovanadium complex
PDB Compounds: (D:) Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

SCOPe Domain Sequences for d5bzxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bzxd2 b.7.1.1 (D:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl
pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd
kanryfspnfkvklyftktv

SCOPe Domain Coordinates for d5bzxd2:

Click to download the PDB-style file with coordinates for d5bzxd2.
(The format of our PDB-style files is described here.)

Timeline for d5bzxd2: