Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein automated matches [190564] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries) |
Domain d5bugd2: 5bug D:188-351 [277820] Other proteins in same PDB: d5buga1, d5bugb1, d5bugc1, d5bugd1 automated match to d1d5ra1 complexed with tla |
PDB Entry: 5bug (more details), 2.4 Å
SCOPe Domain Sequences for d5bugd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bugd2 b.7.1.1 (D:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]} yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd kanryfspnfkvklyftktv
Timeline for d5bugd2: