| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
| Protein automated matches [190564] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries) |
| Domain d5buga2: 5bug A:188-351 [277818] Other proteins in same PDB: d5buga1, d5bugb1, d5bugc1, d5bugd1 automated match to d1d5ra1 complexed with tla |
PDB Entry: 5bug (more details), 2.4 Å
SCOPe Domain Sequences for d5buga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5buga2 b.7.1.1 (A:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl
pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd
kanryfspnfkvklyftktv
Timeline for d5buga2: