Lineage for d5bugc2 (5bug C:188-351)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1775885Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 1776006Protein automated matches [190564] (2 species)
    not a true protein
  7. 1776007Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries)
  8. 1776015Domain d5bugc2: 5bug C:188-351 [277816]
    Other proteins in same PDB: d5buga1, d5bugb1, d5bugc1, d5bugd1
    automated match to d1d5ra1
    complexed with tla

Details for d5bugc2

PDB Entry: 5bug (more details), 2.4 Å

PDB Description: crystal structure of human phosphatase pten oxidized by h2o2
PDB Compounds: (C:) Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

SCOPe Domain Sequences for d5bugc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bugc2 b.7.1.1 (C:188-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl
pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeedndkeylvltltkndldkankd
kanryfspnfkvklyftktv

SCOPe Domain Coordinates for d5bugc2:

Click to download the PDB-style file with coordinates for d5bugc2.
(The format of our PDB-style files is described here.)

Timeline for d5bugc2: