Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein automated matches [190696] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188122] (15 PDB entries) |
Domain d5buga1: 5bug A:14-187 [277815] Other proteins in same PDB: d5buga2, d5bugb2, d5bugc2, d5bugd2 automated match to d1d5ra2 complexed with tla |
PDB Entry: 5bug (more details), 2.4 Å
SCOPe Domain Sequences for d5buga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5buga1 c.45.1.1 (A:14-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryqedgfdldltyiypniiamgfpaerlegvyrnniddvvrfldskhknhykiynlcae rhydtakfncrvaqypfedhnppqlelikpfcedldqwlseddnhvaaihckagkgrtgv micayllhrgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyllknhld
Timeline for d5buga1: