SCOPe 2.06: Domain d1smaa2: 1sma A:506-588

Lineage for d1smaa2 (1sma A:506-588)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermus sp. [TaxId:275] [51032] (2 PDB entries)

8. Domain d1smaa2: 1sma A:506-588 [27781]
   Other proteins in same PDB: d1smaa1, d1smaa3, d1smab1, d1smab3

Details for d1smaa2

PDB Entry: 1sma, 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

PDB Compounds: (A:) maltogenic amylase

SCOPe Domain Sequences for d1smaa2:

Sequence; same for both SEQRES and ATOM records:

>d1smaa2 b.71.1.1 (A:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw

Timeline for d1smaa2:

• d1smaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1smaa2 appears in SCOPe 2.05
  
• d1smaa2 appears in SCOPe 2.07
  
• d1smaa2 appears in the current release, SCOPe 2.08