![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermus sp. [TaxId:275] [51032] (2 PDB entries) |
![]() | Domain d1smaa2: 1sma A:506-588 [27781] Other proteins in same PDB: d1smaa1, d1smaa3, d1smab1, d1smab3 |
PDB Entry: 1sma (more details), 2.8 Å
SCOPe Domain Sequences for d1smaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smaa2 b.71.1.1 (A:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]} gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa aeaetlcvslppygfvlyavesw
Timeline for d1smaa2: