Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Death-associated protein kinase, Dap [75560] (1 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [75561] (20 PDB entries) Uniprot P53355 2-285 |
Domain d5auya_: 5auy A: [277809] automated match to d1jksa_ complexed with mri |
PDB Entry: 5auy (more details), 2 Å
SCOPe Domain Sequences for d5auya_:
Sequence, based on SEQRES records: (download)
>d5auya_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf sntsalakdfirrllvkdpkkrmtiqdslqhpwikp
>d5auya_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekslteeeateflkq ilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpe fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfs ntsalakdfirrllvkdpkkrmtiqdslqhpwikp
Timeline for d5auya_: