Lineage for d5a23c2 (5a23 C:530-655)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968281Family d.106.1.3: Alkylsulfatase C-terminal domain-like [160617] (1 protein)
  6. 2968282Protein Alkylsulfatase SdsA1 [160618] (1 species)
  7. 2968283Species Pseudomonas aeruginosa [TaxId:287] [160619] (6 PDB entries)
    Uniprot Q9I5I9 530-655
  8. 2968290Domain d5a23c2: 5a23 C:530-655 [277793]
    Other proteins in same PDB: d5a23a1, d5a23b1, d5a23c1, d5a23d1
    automated match to d2cfua1
    complexed with zn

Details for d5a23c2

PDB Entry: 5a23 (more details), 2.41 Å

PDB Description: sdsa sulfatase triclinic form
PDB Compounds: (C:) sds hydrolase sdsa1

SCOPe Domain Sequences for d5a23c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a23c2 d.106.1.3 (C:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]}
gsadalaamdtgllfdylgvrldagaaegkalsinlrlpdigenyllelknshlnnlrgv
qsedagqtvsidradlnrlllkevsavrlvfegklkssgnplllgqlfgmlgdfdfwfdi
vtpaak

SCOPe Domain Coordinates for d5a23c2:

Click to download the PDB-style file with coordinates for d5a23c2.
(The format of our PDB-style files is described here.)

Timeline for d5a23c2: