Lineage for d7taa_1 (7taa 382-476)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins) 
Protein Fungal alpha-amylase [51028] (2 species) Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (3 PDB entries) 
Domain d7taa_1: 7taa 382-476 [27778]
Other proteins in same PDB: d7taa_2
Details for d7taa_1
PDB Entry: 7taa (more details), 1.98 Å
PDB Description: family 13 alpha amylase in complex with acarbose
SCOP Domain Sequences for d7taa_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7taa_1 b.71.1.1 (382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics
SCOP Domain Coordinates for d7taa_1:
Click to download the PDB-style file with coordinates for d7taa_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7taa_1:
- d7taa_1 first appeared (with stable ids) in SCOP 1.55
- d7taa_1 appears in SCOP 1.59
- d7taa_1 appears in the current release, SCOPe 2.08, called d7taaa1
View in 3D
