Lineage for d7taa_1 (7taa 382-476)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17369Protein Fungal alpha-amylase [51028] (2 species)
  7. 17372Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (3 PDB entries)
  8. 17373Domain d7taa_1: 7taa 382-476 [27778]
    Other proteins in same PDB: d7taa_2

Details for d7taa_1

PDB Entry: 7taa (more details), 1.98 Å

PDB Description: family 13 alpha amylase in complex with acarbose

SCOP Domain Sequences for d7taa_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7taa_1 b.71.1.1 (382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

SCOP Domain Coordinates for d7taa_1:

Click to download the PDB-style file with coordinates for d7taa_1.
(The format of our PDB-style files is described here.)

Timeline for d7taa_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7taa_2