SCOPe 2.08: Domain d7taaa1: 7taa A:382-476

Lineage for d7taaa1 (7taa A:382-476)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Fungal alpha-amylase [51028] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)

8. Domain d7taaa1: 7taa A:382-476 [27778]
   Other proteins in same PDB: d7taaa2
   complexed with abc, ca

Details for d7taaa1

PDB Entry: 7taa, 1.98 Å

PDB Description: family 13 alpha amylase in complex with acarbose

PDB Compounds: (A:) taka amylase

SCOPe Domain Sequences for d7taaa1:

Sequence; same for both SEQRES and ATOM records:

>d7taaa1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

Timeline for d7taaa1:

• d7taaa1 first appeared (with stable ids) in SCOP 1.55, called d7taa_1
  
• d7taaa1 appears in SCOPe 2.07