| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Pseudo-nitzschia multiseries [TaxId:37319] [277731] (7 PDB entries) |
| Domain d4zlwe_: 4zlw E: [277776] automated match to d1z4aa_ complexed with fe |
PDB Entry: 4zlw (more details), 2 Å
SCOPe Domain Sequences for d4zlwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zlwe_ a.25.1.0 (E:) automated matches {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
Timeline for d4zlwe_: