Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Pseudo-nitzschia multiseries [TaxId:37319] [277731] (7 PDB entries) |
Domain d4zlwb_: 4zlw B: [277771] automated match to d1z4aa_ complexed with fe |
PDB Entry: 4zlw (more details), 2 Å
SCOPe Domain Sequences for d4zlwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zlwb_ a.25.1.0 (B:) automated matches {Pseudo-nitzschia multiseries [TaxId: 37319]} eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln pfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
Timeline for d4zlwb_: