Lineage for d2aaaa1 (2aaa A:382-476)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400568Protein Fungal alpha-amylase [51028] (2 species)
  7. 2400569Species Aspergillus niger, acid amylase [TaxId:5061] [51029] (1 PDB entry)
  8. 2400570Domain d2aaaa1: 2aaa A:382-476 [27777]
    Other proteins in same PDB: d2aaaa2
    complexed with ca

Details for d2aaaa1

PDB Entry: 2aaa (more details), 2.12 Å

PDB Description: calcium binding in alpha-amylases: an x-ray diffraction study at 2.1 angstroms resolution of two enzymes from aspergillus
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2aaaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaaa1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus niger, acid amylase [TaxId: 5061]}
yandafytdsntiamakgtsgsqvitvlsnkgssgssytltlsgsgytsgtklieaytct
svtvdssgdipvpmasglprvllpasvvdssslcg

SCOPe Domain Coordinates for d2aaaa1:

Click to download the PDB-style file with coordinates for d2aaaa1.
(The format of our PDB-style files is described here.)

Timeline for d2aaaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aaaa2