SCOPe 2.05: Domain d1viwa1: 1viw A:379-471

Lineage for d1viwa1 (1viw A:379-471)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)

8. Domain d1viwa1: 1viw A:379-471 [27776]
   Other proteins in same PDB: d1viwa2, d1viwb_
   complexed with ca, cl

Details for d1viwa1

PDB Entry: 1viw, 3 Å

PDB Description: tenebrio molitor alpha-amylase-inhibitor complex

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1viwa1:

Sequence; same for both SEQRES and ATOM records:

>d1viwa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

Timeline for d1viwa1:

• d1viwa1 first appeared (with stable ids) in SCOP 1.55
  
• d1viwa1 appears in SCOPe 2.04
  
• d1viwa1 appears in SCOPe 2.06
  
• d1viwa1 appears in the current release, SCOPe 2.08