Lineage for d4zkxh_ (4zkx H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704552Species Pseudo-nitzschia multiseries [TaxId:37319] [277731] (7 PDB entries)
  8. 2704560Domain d4zkxh_: 4zkx H: [277754]
    automated match to d1z4aa_
    complexed with fe

Details for d4zkxh_

PDB Entry: 4zkx (more details), 1.8 Å

PDB Description: crystal structure of the pmftn variant e44q soaked in iron (5 min)
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d4zkxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zkxh_ a.25.1.0 (H:) automated matches {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf

SCOPe Domain Coordinates for d4zkxh_:

Click to download the PDB-style file with coordinates for d4zkxh_.
(The format of our PDB-style files is described here.)

Timeline for d4zkxh_: