SCOP 1.59: Domain d1tmqa1: 1tmq A:379-471

Lineage for d1tmqa1 (1tmq A:379-471)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins)

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)

8. Domain d1tmqa1: 1tmq A:379-471 [27775]
   Other proteins in same PDB: d1tmqa2, d1tmqb_

Details for d1tmqa1

PDB Entry: 1tmq, 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor

SCOP Domain Sequences for d1tmqa1:

Sequence; same for both SEQRES and ATOM records:

>d1tmqa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

Timeline for d1tmqa1:

• d1tmqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1tmqa1 appears in SCOP 1.57
  
• d1tmqa1 appears in SCOP 1.61
  
• d1tmqa1 appears in the current release, SCOPe 2.08