SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1tmqa1 (1tmq A:379-471)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2066965Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2066994Protein Animal alpha-amylase [51024] (3 species)
  7. 2067065Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)
  8. 2067068Domain d1tmqa1: 1tmq A:379-471 [27775]
    Other proteins in same PDB: d1tmqa2, d1tmqb_
    complexed with ca, cl

Details for d1tmqa1

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1tmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

SCOPe Domain Coordinates for d1tmqa1:

Click to download the PDB-style file with coordinates for d1tmqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tmqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tmqb_