Lineage for d1tmqa1 (1tmq A:379-471)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2066965Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2066994Protein Animal alpha-amylase [51024] (3 species)
  7. 2067065Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)
  8. 2067068Domain d1tmqa1: 1tmq A:379-471 [27775]
    Other proteins in same PDB: d1tmqa2, d1tmqb_
    complexed with ca, cl

Details for d1tmqa1

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1tmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqa1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

SCOPe Domain Coordinates for d1tmqa1:

Click to download the PDB-style file with coordinates for d1tmqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tmqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tmqb_