Lineage for d1clva1 (1clv A:379-471)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63008Protein Animal alpha-amylase [51024] (3 species)
  7. 63029Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)
  8. 63031Domain d1clva1: 1clv A:379-471 [27774]
    Other proteins in same PDB: d1clva2, d1clvi_

Details for d1clva1

PDB Entry: 1clv (more details), 2 Å

PDB Description: yellow meal worm alpha-amylase in complex with the amaranth alpha- amylase inhibitor

SCOP Domain Sequences for d1clva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clva1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

SCOP Domain Coordinates for d1clva1:

Click to download the PDB-style file with coordinates for d1clva1.
(The format of our PDB-style files is described here.)

Timeline for d1clva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1clvi_