![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Pseudo-nitzschia multiseries [TaxId:37319] [277731] (7 PDB entries) |
![]() | Domain d4zkhf_: 4zkh F: [277737] automated match to d1z4aa_ complexed with fe |
PDB Entry: 4zkh (more details), 1.9 Å
SCOPe Domain Sequences for d4zkhf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zkhf_ a.25.1.0 (F:) automated matches {Pseudo-nitzschia multiseries [TaxId: 37319]} seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaqsaeerehglgfvdfan krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf
Timeline for d4zkhf_: