![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Animal alpha-amylase [51024] (3 species) |
![]() | Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries) |
![]() | Domain d1jaea1: 1jae A:379-471 [27773] Other proteins in same PDB: d1jaea2 complexed with ca, cl |
PDB Entry: 1jae (more details), 1.65 Å
SCOPe Domain Sequences for d1jaea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jaea1 b.71.1.1 (A:379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct gksvtvgdngsadislgsaeddgvlaihvnakl
Timeline for d1jaea1: