SCOP 1.71: Domain d1jae_1: 1jae 379-471

Lineage for d1jae_1 (1jae 379-471)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)

8. Domain d1jae_1: 1jae 379-471 [27773]
   Other proteins in same PDB: d1jae_2
   complexed with ca, cl

Details for d1jae_1

PDB Entry: 1jae, 1.65 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase

SCOP Domain Sequences for d1jae_1:

Sequence; same for both SEQRES and ATOM records:

>d1jae_1 b.71.1.1 (379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

Timeline for d1jae_1:

• d1jae_1 first appeared (with stable ids) in SCOP 1.55
  
• d1jae_1 appears in SCOP 1.69
  
• d1jae_1 is called d1jaea1 in SCOP 1.73
  
• d1jae_1 appears in the current release, SCOPe 2.08, called d1jaea1