Lineage for d1jae_1 (1jae 379-471)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17291Protein Animal alpha-amylase [51024] (3 species)
  7. 17306Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51027] (4 PDB entries)
  8. 17307Domain d1jae_1: 1jae 379-471 [27773]
    Other proteins in same PDB: d1jae_2

Details for d1jae_1

PDB Entry: 1jae (more details), 1.65 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase

SCOP Domain Sequences for d1jae_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jae_1 b.71.1.1 (379-471) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
gtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglpagtycdvisgelsggsct
gksvtvgdngsadislgsaeddgvlaihvnakl

SCOP Domain Coordinates for d1jae_1:

Click to download the PDB-style file with coordinates for d1jae_1.
(The format of our PDB-style files is described here.)

Timeline for d1jae_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jae_2