Lineage for d4zbda2 (4zbd A:91-220)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736451Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (8 PDB entries)
  8. 1736452Domain d4zbda2: 4zbd A:91-220 [277727]
    Other proteins in same PDB: d4zbda1, d4zbdb1
    automated match to d4ivfd2
    complexed with gsh

Details for d4zbda2

PDB Entry: 4zbd (more details), 1.12 Å

PDB Description: crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x- ray irradiation at 100k
PDB Compounds: (A:) PcUre2p6

SCOPe Domain Sequences for d4zbda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbda2 a.45.1.0 (A:91-220) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vsvapgtneyytqlqwlyfqasgqgpyygqaawfsvyhpekvpsaieryrneikrvlgvl
esvlskqeflvdgkatvadfsflpwnegaakfllegsqfeeefpatakwhkkllerpaia
kvweerakvs

SCOPe Domain Coordinates for d4zbda2:

Click to download the PDB-style file with coordinates for d4zbda2.
(The format of our PDB-style files is described here.)

Timeline for d4zbda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zbda1