SCOPe 2.07: Domain d4zbbb1: 4zbb B:2-95

Lineage for d4zbbb1 (4zbb B:2-95)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)

8. Domain d4zbbb1: 4zbb B:2-95 [277723]
   Other proteins in same PDB: d4zbba2, d4zbbb2, d4zbbc2, d4zbbd2
   automated match to d1k0ba2
   complexed with act, cl, gdn, gol

Details for d4zbbb1

PDB Entry: 4zbb, 1.8 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s- dinitrobenzene.

PDB Compounds: (B:) PcUre2p8

SCOPe Domain Sequences for d4zbbb1:

Sequence; same for both SEQRES and ATOM records:

>d4zbbb1 c.47.1.0 (B:2-95) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa
lidhgnsdfviwesnamvqyvadkydterkisma

Timeline for d4zbbb1:

• d4zbbb1 first appeared in SCOPe 2.05
  
• d4zbbb1 appears in SCOPe 2.06
  
• d4zbbb1 appears in the current release, SCOPe 2.08