Lineage for d4zbbd2 (4zbb D:96-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713830Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)
  8. 2713846Domain d4zbbd2: 4zbb D:96-222 [277718]
    Other proteins in same PDB: d4zbba1, d4zbbb1, d4zbbc1, d4zbbd1
    automated match to d1k0da1
    complexed with act, cl, gdn, gol

Details for d4zbbd2

PDB Entry: 4zbb (more details), 1.8 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s- dinitrobenzene.
PDB Compounds: (D:) PcUre2p8

SCOPe Domain Sequences for d4zbbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbbd2 a.45.1.0 (D:96-222) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
pgtddfyiqlqwqyfqgtgqgpyfgqlvwftlyheekipsavtrykeealrvfsvlervl
snqewlvggkmtiadisfvswndmivhfldnfdfekefpataawhykmlkrptikrpwde
rrklmsr

SCOPe Domain Coordinates for d4zbbd2:

Click to download the PDB-style file with coordinates for d4zbbd2.
(The format of our PDB-style files is described here.)

Timeline for d4zbbd2: