SCOPe 2.08: Domain d4zbba2: 4zbb A:96-222

Lineage for d4zbba2 (4zbb A:96-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)

8. Domain d4zbba2: 4zbb A:96-222 [277716]
   Other proteins in same PDB: d4zbba1, d4zbbb1, d4zbbc1, d4zbbd1
   automated match to d1k0da1
   complexed with act, cl, gdn, gol

Details for d4zbba2

PDB Entry: 4zbb, 1.8 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s- dinitrobenzene.

PDB Compounds: (A:) PcUre2p8

SCOPe Domain Sequences for d4zbba2:

Sequence; same for both SEQRES and ATOM records:

>d4zbba2 a.45.1.0 (A:96-222) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
pgtddfyiqlqwqyfqgtgqgpyfgqlvwftlyheekipsavtrykeealrvfsvlervl
snqewlvggkmtiadisfvswndmivhfldnfdfekefpataawhykmlkrptikrpwde
rrklmsr

Timeline for d4zbba2:

• d4zbba2 first appeared in SCOPe 2.05
  
• d4zbba2 appears in SCOPe 2.07