Lineage for d4zbba1 (4zbb A:2-95)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134024Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)
  8. 2134037Domain d4zbba1: 4zbb A:2-95 [277715]
    Other proteins in same PDB: d4zbba2, d4zbbb2, d4zbbc2, d4zbbd2
    automated match to d1k0ba2
    complexed with act, cl, gdn, gol

Details for d4zbba1

PDB Entry: 4zbb (more details), 1.8 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s- dinitrobenzene.
PDB Compounds: (A:) PcUre2p8

SCOPe Domain Sequences for d4zbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbba1 c.47.1.0 (A:2-95) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa
lidhgnsdfviwesnamvqyvadkydterkisma

SCOPe Domain Coordinates for d4zbba1:

Click to download the PDB-style file with coordinates for d4zbba1.
(The format of our PDB-style files is described here.)

Timeline for d4zbba1: