Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries) |
Domain d4zbba1: 4zbb A:2-95 [277715] Other proteins in same PDB: d4zbba2, d4zbbb2, d4zbbc2, d4zbbd2 automated match to d1k0ba2 complexed with act, cl, gdn, gol |
PDB Entry: 4zbb (more details), 1.8 Å
SCOPe Domain Sequences for d4zbba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zbba1 c.47.1.0 (A:2-95) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]} ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa lidhgnsdfviwesnamvqyvadkydterkisma
Timeline for d4zbba1: