![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries) |
![]() | Domain d4zb9a2: 4zb9 A:96-221 [277710] Other proteins in same PDB: d4zb9a1, d4zb9b1, d4zb9c1, d4zb9d1 automated match to d1k0da1 complexed with cl, gds |
PDB Entry: 4zb9 (more details), 2.4 Å
SCOPe Domain Sequences for d4zb9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zb9a2 a.45.1.0 (A:96-221) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]} pgtddfyiqlqwqyfqgtgqgpyfgqlvwftlyheekipsavtrykeealrvfsvlervl snqewlvggkmtiadisfvswndmivhfldnfdfekefpataawhykmlkrptikrpwde rrklms
Timeline for d4zb9a2: